A Python toolkit for Antimicrobial Peptide (AMP) prediction and physicochemical assessment
////////////////////////////////////////////////////////////////////////
// //
// _ __ __ ____ _ _ _ _ __ _ //
// / \ | \/ | _ \(_) __| | ___ _ __ | |_(_)/ _(_) ___ _ __ //
// / _ \ | |\/| | |_) | |/ _` |/ _ \ '_ \| __| | |_| |/ _ \ '__| //
// / ___ \| | | | __/| | (_| | __/ | | | |_| | _| | __/ | //
// /_/ \_\_| |_|_| |_|\__,_|\___|_| |_|\__|_|_| |_|\___|_| //
// //
////////////////////////////////////////////////////////////////////////
AMPidentifier is an open-source, modular Python toolkit for predicting Antimicrobial Peptides (AMPs) from amino acid sequences. It combines three pre-trained Machine Learning models (Random Forest, SVM, Gradient Boosting) with an ensemble voting system, and computes dozens of physicochemical descriptors via modlamp.
Users can run predictions with the built-in models, combine them in ensemble mode, or integrate external .pkl models for side-by-side comparison.
AMPidentifier is officially published on the Python Package Index (PyPI) at https://pypi.org/project/ampidentifier/ and can be installed directly via pip install ampidentifier. PyPI publication ensures that every release is versioned, indexed, and permanently accessible, which is essential for reproducibility in scientific workflows: researchers can cite a specific version and reproduce results exactly, regardless of when or where the analysis is run.
| Project | Description | Link |
|---|---|---|
| AMPidentifier CLI | Full command-line version with training scripts, benchmarking, and extended documentation | github.com/madsondeluna/AMPidentifier |
| AMPidentifier Web Server | Browser-based interface for AMP prediction (no installation required) | github.com/madsondeluna/AMPidentifierServerBETA |
pip install ampidentifierWe recommend using a virtual environment:
python3 -m venv venv
source venv/bin/activate # macOS/Linux
# venv\Scripts\activate # Windows
pip install ampidentifierAvailable on PyPI: https://pypi.org/project/ampidentifier/
# Single model (Random Forest, default)
ampidentifier --input my_sequences.fasta --output_dir ./results
# Ensemble voting (recommended)
ampidentifier --input my_sequences.fasta --output_dir ./results --ensemble
# Compare SVM with an external model
ampidentifier --input my_sequences.fasta --output_dir ./results --model svm --external_models /path/to/my_model.pklThe examples below use this sample FASTA file (test_peptides.fasta) containing known AMPs and non-AMP peptides for demonstration:
>Magainin-2|Xenopus_laevis|Cationic_amphipathic_helix
GIGKFLHSAKKFGKAFVGEIMNS
>LL-37|Homo_sapiens|Cathelicidin_family
[LL-37, 37 aa]
>Melittin|Apis_mellifera|Venom_peptide
GIGAVLKVLTTGLPALISWIKRKRQQ
>Insulin_Chain_B|Homo_sapiens|Peptide_hormone
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>Glucagon|Homo_sapiens|Peptide_hormone
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
>Vasoactive_intestinal_peptide|Homo_sapiens|Neuropeptide
HSDAVFTDNYTRLRKQMAVKKYLNSILN
Click the badge to open the demo notebook directly in Colab:
Or run the cells below manually in any Colab notebook:
# Cell 1: Install
!pip install ampidentifier# Cell 2: Create the example FASTA file
fasta_content = """>Magainin-2|Xenopus_laevis|Cationic_amphipathic_helix
GIGKFLHSAKKFGKAFVGEIMNS
>LL-37|Homo_sapiens|Cathelicidin_family
[LL-37, 37 aa]
>Melittin|Apis_mellifera|Venom_peptide
GIGAVLKVLTTGLPALISWIKRKRQQ
>Insulin_Chain_B|Homo_sapiens|Peptide_hormone
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>Glucagon|Homo_sapiens|Peptide_hormone
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
>Vasoactive_intestinal_peptide|Homo_sapiens|Neuropeptide
HSDAVFTDNYTRLRKQMAVKKYLNSILN
"""
with open("test_peptides.fasta", "w") as f:
f.write(fasta_content)
print("FASTA file created with 6 sequences (3 known AMPs + 3 non-AMPs)")# Cell 3: Run with default model (Random Forest)
# Import the pipeline function directly from the package
import os
from amp_identifier.core import run_prediction_pipeline
os.makedirs("./results_rf", exist_ok=True)
run_prediction_pipeline(
input_file="test_peptides.fasta",
output_dir="./results_rf",
internal_model_type="rf", # Random Forest: best single-model AUC-ROC (0.9503)
use_ensemble=False,
external_model_paths=[],
)# Cell 4: Run with ensemble mode (recommended)
# Combines RF + SVM + GB via majority voting for maximum robustness
import os
from amp_identifier.core import run_prediction_pipeline
os.makedirs("./results_ensemble", exist_ok=True)
run_prediction_pipeline(
input_file="test_peptides.fasta",
output_dir="./results_ensemble",
internal_model_type="rf", # ignored when use_ensemble=True
use_ensemble=True, # activates majority vote across all three models
external_model_paths=[],
)# Cell 5: Inspect results
# Runs ensemble first if output does not exist yet, then displays results
import os
import pandas as pd
from amp_identifier.core import run_prediction_pipeline
report_path = "./results_ensemble/prediction_comparison_report.csv"
features_path = "./results_ensemble/physicochemical_features.csv"
if not os.path.exists(report_path):
os.makedirs("./results_ensemble", exist_ok=True)
run_prediction_pipeline(
input_file="test_peptides.fasta",
output_dir="./results_ensemble",
internal_model_type="rf",
use_ensemble=True,
external_model_paths=[],
)
report = pd.read_csv(report_path)
print("=== Ensemble Prediction Report ===")
print(report.to_string(index=False))
features = pd.read_csv(features_path)
print(f"\n=== Physicochemical Features ===")
print(f"Shape: {features.shape[0]} sequences x {features.shape[1]} descriptors")
print(features[['ID', 'Length', 'Charge', 'HydrophRatio']].to_string(index=False))# Cell 6: Compare all three internal models individually
import os
import pandas as pd
from amp_identifier.core import run_prediction_pipeline
for model in ["rf", "svm", "gb"]:
os.makedirs(f"./results_{model}", exist_ok=True)
run_prediction_pipeline(
input_file="test_peptides.fasta",
output_dir=f"./results_{model}",
internal_model_type=model,
use_ensemble=False,
external_model_paths=[],
)
report = pd.read_csv(f"./results_{model}/prediction_comparison_report.csv")
pred_col = [c for c in report.columns if c.startswith("pred_")][0]
amp_count = int(report[pred_col].sum())
print(f"[{model.upper()}] Predicted AMPs: {amp_count}/6")| Argument | Description | Required | Default |
|---|---|---|---|
-i, --input |
Path to the input FASTA file | Yes | none |
-o, --output_dir |
Path to the output directory | Yes | none |
-m, --model |
Internal model to use: rf, svm, gb |
No | rf |
--ensemble |
Enable majority-vote ensemble across all internal models | No | Flag |
-e, --external_models |
One or more paths to external .pkl models for comparison (comma-separated) |
No | none |
- Three pre-trained ML models: Random Forest, Gradient Boosting, SVM
- Ensemble voting: Majority vote across all models for improved robustness
- External model support: Load custom
.pklmodels for comparison - Physicochemical descriptors: Compute and export an extensive set of sequence features via
modlamp - Fully open-source and modular: Each component can be used independently
Best values per metric in bold.
| Metric | Random Forest (RF) | SVM | Gradient Boosting (GB) |
|---|---|---|---|
| Accuracy | 0.8845 | 0.8740 | 0.8585 |
| Precision | 0.8910 | 0.8880 | 0.8665 |
| Recall | 0.8762 | 0.8558 | 0.8475 |
| F1-Score | 0.8836 | 0.8716 | 0.8569 |
| MCC | 0.7692 | 0.7484 | 0.7172 |
| AUC-ROC | 0.9503 | 0.9356 | 0.9289 |
Recommended: use --ensemble for most robust predictions (Accuracy: 87.47%, Sensitivity: 85.96%, Specificity: 88.98%).
| File | Description |
|---|---|
physicochemical_features.csv |
Computed physicochemical descriptors for each input sequence |
prediction_comparison_report.csv |
AMP/non-AMP predictions with confidence scores per model and consensus |
amp_identifier/
├── __init__.py
├── core.py # Main prediction workflow
├── data_io.py # FASTA input reader
├── feature_extraction.py # Physicochemical descriptor computation
├── prediction.py # Model loading and inference
└── reporting.py # CSV report generation
| Name | Role | Affiliation |
|---|---|---|
| Madson A. de Luna-Aragão, MSc | Lead developer; architecture; ML; docs | UFMG |
| Rafael L. da Silva, BSc | Collaborator; preprocessing; pipeline testing | UFPE |
| Ana M. Benko-Iseppon, PhD | Advisor; study design; biological validation | UFPE |
| João Pacífico, PhD | Co-Advisor; computational review; evaluation | UPE |
| Carlos A. dos Santos-Silva, PhD | Co-Advisor; pipeline testing; review | CESMAC |
- Officially registered under UFPE - Universidade Federal de Pernambuco, Brazil
- Supported by FACEPE - Fundação de Amparo à Pesquisa do Estado de Pernambuco
- INPI Registration: BR 51 2025 005859-4
Luna-Aragão, M. A., da Silva, R. L., Pacífico, J., Santos-Silva, C. A. & Benko-Iseppon, A. M.
(2025). AMPidentifier: A Python toolkit for predicting antimicrobial peptides using ensemble
machine learning and physicochemical descriptors.
https://github.com/madsondeluna/AMPidentifier
This project is licensed under the terms specified in the repository. All rights reserved.